PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DS_4F7973584.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 266aa    MW: 28266.6 Da    PI: 5.5455
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DS_4F7973584.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1284.8e-0991135852
                            HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                            +r   NR A r++R++Kka ++ Lee+v +L+a Nk+L k+l++ 
  Traes_5DS_4F7973584.1  91 KRPSGNRAAVRKYREKKKAHTALLEEEVVQLKALNKQLLKKLQNH 135
                            56667**********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-684151IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-1287152No hitNo description
PfamPF077162.1E-1389141IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-789135No hitNo description
CDDcd146867.57E-1196134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDDGDLDFSN PEAYLDTGAD LPGGGCSMDS YFDEYLNDTE HLACTHTHTC NPPVDDSSHT  60
HTCVHVHTKI VSASSDGGAD SPAENSGASK KRPSGNRAAV RKYREKKKAH TALLEEEVVQ  120
LKALNKQLLK KLQNHAALEA EAARLRCLLV DIRGRIDGEI GTFPYQRPVK NGDLVSGVDQ  180
GGFLGSAQVM NSCDFRCNDQ MYCNPGMQMR AMGDDGAMSG QVFGQGTGDI ANIQCMGGAK  240
SGFTMPPGCG GMGTMPSGCL PGSEKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563276.11e-149PREDICTED: uncharacterized protein LOC100823660
SwissprotQ8VY762e-72BZP19_ARATH; Basic leucine zipper 19
TrEMBLW5G2D50.0W5G2D5_WHEAT; Uncharacterized protein
STRINGMLOC_60894.11e-160(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-43bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]